PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07346g02005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 582aa    MW: 64731.9 Da    PI: 6.5933
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07346g02005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-093804122254
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               ++yp+ +++  LAk++gL+ +qV++WF N R +
  Niben101Scf07346g02005.1 380 HPYPTDSDKVMLAKQTGLSRNQVSNWFINARVR 412
                               89*****************************88 PP

2BELL94.78.1e-31242311372
                      BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                e+++ k+ L+s+l+eV++rYkqy++qlq+v++sFe v glg+a+p+++l lka+S+hFrcLk+ai++q+
  Niben101Scf07346g02005.1 242 SEHRRNKSMLISMLNEVYRRYKQYYQQLQAVVASFESVPGLGNAAPFAKLSLKALSKHFRCLKNAITDQL 311
                               68999**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-39179309IPR006563POX domain
PfamPF075265.4E-33184308IPR006563POX domain
PROSITE profilePS5007111.985353416IPR001356Homeobox domain
SMARTSM003892.6E-10356420IPR001356Homeobox domain
CDDcd000866.54E-12356417No hitNo description
Gene3DG3DSA:1.10.10.602.0E-27359420IPR009057Homeodomain-like
SuperFamilySSF466897.7E-17361423IPR009057Homeodomain-like
PfamPF059201.4E-18373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MAEGFEPYHV PQQSRRDRLR VSASGLLPFV DHPSLIPSDF LLVSDAKEKG VNFMDPQLSS  60
GVSFQEINGN PFLYSHQNFR FLDQSFHGGD VDVAYKQEPF SSIAASPETN VIINNNSNSN  120
NNVTTGQGLS LSLSSSHHYN LSSSSNLPLE LNLQRYDSSI YTNEMSSKSS ATVPLGPFTG  180
YASILKGSRF LKLAQQLLEE LCDDGRGIYV EKLAANDDFV LMDSSLEIPL SDDPQYSCGD  240
GSEHRRNKSM LISMLNEVYR RYKQYYQQLQ AVVASFESVP GLGNAAPFAK LSLKALSKHF  300
RCLKNAITDQ LQCTGKSHNC ESDLSIPRVG NPAGKGIYCQ RQAIHSAGFV DHQPVWRSQR  360
GLPERAVTVL RAWLFDHFLH PYPTDSDKVM LAKQTGLSRN QVSNWFINAR VRLWKPMVEE  420
IHNLETRQAQ KEASQKEEQN NNNNPIEHFP TEHPSTSSQQ FQDVPSKRTR NNDPSETHLG  480
GDNQETMYLS YDNFSPHSRA GVVDQMSTAS AGSGGVSLTL GLNQNNNVSI GLSGSFPRNA  540
ARRFGIDENN EGFMFGGFES QNRQLGRDNN IIGGHLLHDF VG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-16362420563Homeobox protein Meis2
4xrm_B6e-16362420563Homeobox protein Meis2
4xrs_A6e-16362419158Homeobox protein Meis1
4xrs_B6e-16362419158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016477978.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLF6HL250.0F6HL25_VITVI; Putative uncharacterized protein
STRINGVIT_08s0007g01290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA35202237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.14e-94TALE family protein